PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_6DL_29F162FB2.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family NF-YA
Protein Properties Length: 307aa    MW: 33384.1 Da    PI: 11.0323
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_6DL_29F162FB2.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA104.41e-32150206158
              CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                            dep++VN+KQy++Il+RRq Rakle+++kl +k+rkpylheSRh hA++R+RgsgGrF
  Traes_6DL_29F162FB2.2 150 DEPIFVNPKQYNGILRRRQLRAKLEAQNKL-TKNRKPYLHESRHLHAMKRARGSGGRF 206
                            79****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005212.6E-37148209IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115237.727149209IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.3E-28151206IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006163.4E-22152174IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006163.4E-22183206IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MDKRESPSGV TRSRRGVRGA DREGAQRDGG GKLASRGRTH RERAAGGRRR VGAMLLPSSS  60
SSSYDPKGDS FGKSVDDHMR STLTFGDKHS VFASQNTDYG HPMACISYPF NDSGSVWAAY  120
GSRAMFQPLM AEGGASATAR VPLPVELAAD EPIFVNPKQY NGILRRRQLR AKLEAQNKLT  180
KNRKPYLHES RHLHAMKRAR GSGGRFLNSK QLKQQQQQSG SACTKAIADG ANSLGSTHLR  240
LGSGAAGDRS NSASKAMSSQ ENSKRVAAPA PAFTMIQAAR KDDDFFHHHG HHLSFSDHFG  300
QSSDRYT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A5e-20150211263NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0089360.0BT008936.1 Triticum aestivum clone wdi1c.pk002.b10:fis, full insert mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003570525.11e-126PREDICTED: nuclear transcription factor Y subunit A-4 isoform X1
TrEMBLW5GV080.0W5GV08_WHEAT; Uncharacterized protein
STRINGMLOC_36554.11e-145(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP132762833
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G54160.13e-36nuclear factor Y, subunit A5
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]